關於 sly synonym ，我們在網路上蒐集到這些相關的討論、資訊與評價

#11. 1000+ Synonyms & Antonyms for SLY - Power Thesaurus

What's the definition of Sly in thesaurus? Most related words/phrases with sentence examples define Sly meaning and usage.

#12. Another word for SLY > Synonyms & Antonyms

1. sly ... adjective. ['ˈslaɪ'] marked by skill in deception. Synonyms. slick · crafty · wily · cunning · tricksy · tricky · artful ...

#13. Synonym til sly på engelsk - Norsk synonymordbok

Leter du etter synonymer til sly? Vi har 11 synonymer for ordet sly på engelsk. · Adjektiv · Legg til synonym.

#14. 910 Sly Synonyms. Similar words for Sly. - Thesaurus.plus

cunning. ability, property crafty. cunning, ability wily. cunning, crafty tricky. cunning, ability foxy. crafty, ability artful. cunning, crafty guileful. cunning, ability slick. ...

#15. Sly | English Thesaurus - SpanishDict

Synonyms and Antonyms of Sly. Learn synonyms, antonyms, and opposites of Sly in English with Spanish translations of every word.

#16. SLY Synonyms: 50 Other Similar and Related Words in English

Find sly synonyms list of more than 50 words on Pasttenses thesaurus. It conatins accurate other and similar related words for sly in English.

#17. Sly - Synonym.tech

Popular synonyms for Sly and phrases with this word. Words with similar meaning of Sly at Thesaurus dictionary Synonym.tech.

#18. sly synonyms - Meanings and Definitions

Sly synonym. Synonyms for sly at english dictionary. What is a synonym for sly? Slang synonyms for Sly.

#19. Choose the synonym of Sly - Byju's

The correct option is A. Shrewd. Sly - shrewd · Hindustan Unilever has oligopolistic powers. · Choose the synonym of. Villain · Choose the synonym of. Suitable.

#20. Sly synonyms - Thesaurus - RhymeZone

Synonyms and other words related to Sly: Closest meaning first, A → Z, Most lyrical, Most funny-sounding, Most modern, Oldest, Shortest, Longest ...

#21. Synonyms for sly - iSYNONYM

On this page you will find all the synonyms for the word to sly. Synonyms for sly - wily, mischievous, shrewd, shifty, furtive, slick and others.

#22. Synonyms of sly, sly synonym - Ichacha

sly synonyms. pronunciation: sly 's definition · crafty, cunning, dodgy, foxy, guileful, knavish, slick ...

#23. English Thesaurus | sly Synonyms and Antonyms - wordow.com

sly Thesaurus · Anagrams (1). YLS · Idioms or Phrases (4). on the slysly as a foxby the slysly fox · Homorhymes (50+) + -. ibymythyhighwhyeyedietrycryliereplysky ...

#24. sly: meaning, synonyms - WordSense Dictionary

WordSense Dictionary: sly - ✓ meaning, ✓ definition, ✓ synonyms, ✓ translations, ✓ origin, ✓ anagrams.

#25. Sly — synonyms, definition

Synonyms for the word Sly, all found — 63, antonyms — 0. Definition of «Sly». All the words are sorted alphabetically.

#26. Synonyms and Related Words. What is Another Word for SLY?

The synonyms of “Sly” are: crafty, cunning, dodgy, foxy, guileful, knavish, slick, tricksy, tricky, wily, clever, artful, conniving, ...

#27. Sly ka synonyms | similar word of Sly - YouTube

Hello everyone I am asif iqbal and you are watching indian spoken english . Topic cover in this video :- 1 :- Synonyms of Sly2 :- Sly ka ...

#28. Synonyms and Similar words for SLY - ShabdKhoj

Find all similar words with meaning for SLY. Use Hindi ShabdKhoj to find all synonyms of SLY. ... Synonym check result for word: SLY ...

#29. SLY crossword clue - All synonyms & answers

Synonyms, crossword answers and other related words for SLY ; sly 4 letter words. arch cagy clan cute ; sly 5 letter words. acute cagey canny creep ; sly 6 letter ...

#30. sly | meaning of sly - Longman Dictionary

... cunning▻ see thesaurus at dishonest2 → sly smile/glance/wink etc3 → on the sly —slyly adverb —slyness noun [uncountable]Examples from the Corpussly• ...

#31. C84903 - NCI Thesaurus

Preferred Name: Sly Syndrome. Definition: A rare autosomal recessive lysosomal storage disease caused by deficiency of the enzyme beta-glucuronidase.

#32. Slyly Synonyms

Slyly Synonyms Meanings Synonyms Unique Words Related Words In an artful manner (Adverb) Synonyms: craftily cunningly foxily knavishly trickily artfully ...

#33. sly devil synonym - Dictionary - Reverso

sly devil translation in English - English Reverso dictionary, see also 'devilry, devilish, ... sly devil synonym, sly devil definition | Thesaurus.

#34. How to pronounce sly in English - Forvo

The definition of sly is: marked by skill in... ... Learn how to pronounce sly and improve your English at Forvo Academy! ... Synonyms of sly.

#35. SLY Crossword Clue & Synonyms

Synonyms for SLY · Sly · slyly · Sly one · slyness · Sly ___ fox · Sly guy · Sly 'Hey!' · Sly look ...

#36. Select the most appropriate ANTONYM of the given word. SLY

The most appropriate antonym of the given word 'Sly' is 'Honest'. · Sly: (used about a person) acting or done in a secret or dishonest way, often intending to ...

#37. * Write the synonyms of the words given below. Use help box ...

Find an answer to your question * Write the synonyms of the words given below. Use help box, little, sly, wealthy, quiet, difficult, ill, ...

#38. Synonymer till sly

Föreslå en synonym eller ett motsatsord till sly. | Nytt ord? Vad betyder sly? bestånd av unga träd eller buskar || -et.

#39. Malay Meaning of Sly - Jenson.in

Malay synonym of the english word Sly. Sly meaning in Malay. Online English Malay Dictionary With hundred thousands of Words meaning.

#40. Sly Meaning in Hindi, Synonyms, Antonyms | SamanyaGyan

Honest, Straightforward, Dull, are antonyms of the Sly word. What type word is Sly? Sly is a Adjective word.

#41. sly meaning in Konkani कोंकणी #KHANDBAHALE

sly meaning in Konkani कोंकणी is a translation of sly in Konkani कोंकणी dictionary. Click for meanings of sly, including synonyms, antonyms.

#42. schlau - synonyms, antonyms, thesaurus - German Dictionary

Synonyms German adjective schlau (sly, smart): abgefeimt, ausgefuchst, ausgekocht, baue… with synonyms, antonyms, related terms and descriptions in the ...

#43. ¿Cuál es la diferencia entre sly y cunning y crafty ... - HiNative

Synonym for sly Sly means to be sneaky and in some contexts dishonest so it has a negative connotation if you were applying this to a person ...

#44. Slyly Synonym & meaning | Slyly Antonym & opposite meaning

In a sly manner, cunningly. Synonyms for slyly. No Record Found. Antonyms for slyly. No Record Found. Follow Us: Popular Chapters by Class: Class 6.

#45. Throw a monkey wrench synonym. Antonyms for Cripple ...

BuzzWord. throw a wrench in the works (English) Alternative forms 13 Throw a monkey wrench into synonyms that start with letter C. Thanks for visiting The ...

#46. Slang for "sly cat " (Related Terms) - Urban Thesaurus

According to the algorithm behind Urban Thesaurus, the top 5 slang words for "sly cat " are: clyne, pussy, moosh, catmandu, and neko. There are 1198 other ...

#47. slyly - Synonyms, Antonyms and Pronunciation - Digopaul.com

Learn more about English word: slyly, including definition, synonyms, antonym, ... adv.Insidiously; slyly unfaithful; sly; WebCunningly; impishly; secretly ...

#48. sympathetic: OneLook Thesaurus

Synonyms and related words for sympathetic from OneLook Thesaurus, a powerful English thesaurus and brainstorming tool that lets you describe what you're ...

#49. इंग्रजी Synonyms for Talathi Bharti 2023 - MahaSarkar

Words having the same meaning as a given word are called synonyms. ... c) Sly. d) Hearty. (35) Glamourous = a)Brilliant. b) Gullible.

#50. Synonym til smith-sly - kryssord.org

Ord Ant. ord Lengde Bruker Dato mellomdistanseløper 1 19 6 2010‑07‑11 britisk mellomdistanseløper 2 26 7 2011‑04‑11 engelsk mellomdistanseløper 2 26 7 2011‑04‑11

#51. Shed light thesaurus. Hold to adjust. Harold Ross. throw light.

shedding light. Related terms for can shed some light- synonyms, antonyms and sentences with can shed some light. Synonyms Similar meaning. Antonyms for sheds.

#52. Scientific racism - Wikipedia

Scientific racism, sometimes termed biological racism, is the pseudoscientific belief that ... sly, lazy, negligent; anoints themself with grease; governed by caprice.

#53. Lurking definition

Wiktionary Synonyms: gliding mousing pussyfooting creeping snaking sneaking ... Definition of lurk 1 as in to sneak to move about in a sly or secret manner ...

#54. lame-o, adj. & n. meanings, etymology and more

View in Historical Thesaurus. noun. 1977–. A person regarded as socially inept or out of touch; a dull, unimpressive, or contemptible person.

#55. 550+ Alternative Words for "Said" - Owlcation

Synonyms for "Say". Verbs that mean the same thing as "say." speak. utter.

#56. Is slapping considered abuse. In addition ... - skipsrus.sydney

Hit and beat are both synonyms, they are both generic terms for strike, but often are A physical abuse is also considered in the State of Virginia when a ...

#57. Jealous synonym positive. Consider speaking with your ...

Synonyms for SNEAKY: shady, sly, stealthy, shifty, furtive, cheating, sneaking, slippery; Antonyms of SNEAKY: straightforward, forthright, direct, open, ...

#58. Japanese Names - Behind the Name

expand search to include close synonyms. expand search to include subclasses. expand search to related names. separate search terms with spaces ...

#59. Rootlessness meaning in bengali. Definitions for the word, root

This phrase is also commonly used as a synonym to Fatafati. pe·riph·er·al. ... Synonyms for Isolation. without any clear intentions, purpose, or direction: ...

#60. English exercises for adults. English Writing Exercises for B1 ...

Several exercises including context clues, word matching, definition, synonym-antonym, word formation, prefixes, suffixes, root, and more Also see: Drag and ...

#61. Lian kuea ao3. He tenderly brushed their noses together and sm

Lian Kilen Wang/Kuea Keerati has been made a synonym of Kuea Keerati/Lian Kilen Wang. It follows Xie Lian, a gentle young man who becomes the target of Hua ...

#62. Sending love and hugs quotes. They're the easiest way to spr

Here's a list of similar words from our thesaurus that you can use instead. A deep hug to convey my thanks to you for coming into my life. kathy love.

#63. meaning, Definition Synonyms at English to Urdu dictionary ...

Urdu meanings of "wrought iron" with examples,pronunciation, synonyms and similar words. Mcga . ... Crafty; sly; artful; designing; deceitful.

#64. Cost of cat euthanasia and cremation. Funeral & Cremation Serv

Some common synonyms are “putting to sleep”, “put to sleep”, “put down”, “euthanize”, “mercy killing”, “humane end of suffering”, “painless death”. and over ...

#65. 無題

... Webster's Lumasaaba - English Thesaurus Dictionary|Philip M. Parker, ... of Leicestershire (Grim Almanacs)|Nicola Sly, Thomas Wolfe|Elizabeth NOWELL, ...

#66. Stand bye. Based on a novella by Stephen King, the story ...

Synonyms for STAND BY: keep (to), abide by, hold to, live up to, defend, ... "Stand" by Sly & The Family StoneListen to Sly & The Family Stone: ...

#67. Swahili-English Dictionary - Translation Directory

quick; light; fast; rapid; swift. -erevu adj. clever; cunning; smart; sly. -erevuka v. become clever. eti conj. that (namely).

#68. Taxi riddim 1989 zip

... Sly amp; Robbie have got also worked with Elegance Jones, ... References · Rhymes · Scripts · Symbols · Synonyms · Zip Codes.

#69. Reveal synonym evil. ) causing great harm and misery

Full list of synonyms for Evil eye is here. past simple and past participle of ... misleading, sly; Antonyms of TRICK: straightforward, direct, open, plain, ...